PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN34796.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 362aa    MW: 40475.4 Da    PI: 7.2748
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN34796.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.4e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd  l+ ++++ G+g +W + ++++g++R++k+c++rw++yl
       KHN34796.1 14 KGPWSPEEDAALKAYIEKNGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.92e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
       KHN34796.1  69 GGFTEEEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.217962IPR017930Myb domain
SuperFamilySSF466891.04E-2611109IPR009057Homeodomain-like
SMARTSM007174.8E-121364IPR001005SANT/Myb domain
PfamPF002492.4E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-241569IPR009057Homeodomain-like
CDDcd001677.78E-91662No hitNo description
PROSITE profilePS5129422.10963117IPR017930Myb domain
SMARTSM007172.3E-1167115IPR001005SANT/Myb domain
PfamPF002496.0E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2370117IPR009057Homeodomain-like
CDDcd001672.44E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAALKAYIE KNGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FTEEEDNIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGR  120
RKQSNLSAKD TNNGIEENSY SNALSSSALE RLQLHMQLQS LQNPFSFYNN PALWPKLHPF  180
QEKMIQSLQS LNDGSSPVMQ NALPNSPHVE QGQKDEFCKP QHDGAKINNP QVHLLENIPL  240
SNGGVPFVAS GSSKNPMHSS LAPRSEAIHE QTNSVGFQQL GALQTELDDI LNNRIMGYVP  300
HEDHDMAGFD CFREMNSSKD SLIWWSNDSD TKSVSSNSWD SSATPALLPQ GMFQDYELGY  360
SL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-23141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006593553.10.0PREDICTED: transcription factor RAX1
SwissprotQ9FKL21e-101MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A0B2RJR10.0A0A0B2RJR1_GLYSO; Transcription factor RAX3
TrEMBLI1LVT60.0I1LVT6_SOYBN; Uncharacterized protein
STRINGGLYMA13G01200.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.19e-90myb domain protein 36
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]